Lineage for d4i62a_ (4i62 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2146226Species Streptococcus pneumoniae [TaxId:637987] [193477] (7 PDB entries)
  8. 2146227Domain d4i62a_: 4i62 A: [252588]
    automated match to d3vv5a_
    complexed with arg, cl

Details for d4i62a_

PDB Entry: 4i62 (more details), 1.05 Å

PDB Description: 1.05 Angstrom crystal structure of an amino acid ABC transporter substrate-binding protein AbpA from Streptococcus pneumoniae Canada MDR_19A bound to L-arginine
PDB Compounds: (A:) Amino acid ABC transporter, periplasmic amino acid-binding protein, putative

SCOPe Domain Sequences for d4i62a_:

Sequence, based on SEQRES records: (download)

>d4i62a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
ieaikskgklvvalnpdfapfeyqkvvdgknqivgsdielakaiatelgvelelspmsfd
nvlasvqsgkadlaisgvsktderskvfdfstpyytaknklivkksdlatyqsvndlaqk
kvgaqkgsiqetmakdllqnsslvslpkngnlitdlksgqvdavifeepvakgfvennpd
laiadlnfekeqddsyavamkkdskelkeavdktiqklkesgeldkliedafkasiek

Sequence, based on observed residues (ATOM records): (download)

>d4i62a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
ieaikskgklvvalnpdfapfeyqkvvdgknqivgsdielakaiatelgvelelspmsfd
nvlasvqsgkadlaisgvsktderskvfdfstpyytaknklivkksdlatyqsvndlaqk
kvgaqkgsiqetmakdllqnsslvslpkngnlitdlksgqvdavifeepvakgfvennpd
laiadlnfekqddsyavamkkdskelkeavdktiqklkesgeldkliedafkasiek

SCOPe Domain Coordinates for d4i62a_:

Click to download the PDB-style file with coordinates for d4i62a_.
(The format of our PDB-style files is described here.)

Timeline for d4i62a_: