SCOPe 2.08: Domain d4i3rl2: 4i3r L:107-214

Lineage for d4i3rl2 (4i3r L:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4i3rl2: 4i3r L:107-214 [252587]
   Other proteins in same PDB: d4i3rh_, d4i3rl1
   automated match to d1dn0a2
   complexed with nag

Details for d4i3rl2

PDB Entry: 4i3r, 3 Å

PDB Description: crystal structure of the outer domain of hiv-1 gp120 in complex with vrc-pg04 space group p3221

PDB Compounds: (L:) Light chain of VRC-PG04 Fab

SCOPe Domain Sequences for d4i3rl2:

Sequence; same for both SEQRES and ATOM records:

>d4i3rl2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4i3rl2:

• d4i3rl2 first appeared in SCOPe 2.04
  
• d4i3rl2 appears in SCOPe 2.07