Lineage for d4i3fa1 (4i3f A:1-282)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152839Species Cycloclasticus sp. [TaxId:385025] [256296] (1 PDB entry)
  8. 2152840Domain d4i3fa1: 4i3f A:1-282 [252585]
    Other proteins in same PDB: d4i3fa2
    automated match to d4lxga_
    complexed with cl, na, peg

Details for d4i3fa1

PDB Entry: 4i3f (more details), 1.69 Å

PDB Description: Crystal structure of serine hydrolase CCSP0084 from the polyaromatic hydrocarbon (PAH)-degrading bacterium Cycloclasticus zankles
PDB Compounds: (A:) serine hydrolase CCSP0084

SCOPe Domain Sequences for d4i3fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i3fa1 c.69.1.0 (A:1-282) automated matches {Cycloclasticus sp. [TaxId: 385025]}
mqtsniqtgsfntflneagtdkdtsilllhgsgpganamsnwqyalpflaenyhclapdi
agfglsqhncppngtshwidiwvqqqidlldakgieqthivgnsmgggvtlhllnrhper
fkkavlmgpvgapfaptegltkgwefykdpskealeylitkflfdpsllgndiasiaaqr
fdnvmkdevrlqfeamfsggtkkgidafvlsddelnnishqmlvtharedffiplnnayy
lidripnaqlhvfdhcghwvqiekkkafnnltklffdgmfdd

SCOPe Domain Coordinates for d4i3fa1:

Click to download the PDB-style file with coordinates for d4i3fa1.
(The format of our PDB-style files is described here.)

Timeline for d4i3fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i3fa2