Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Cycloclasticus sp. [TaxId:385025] [256296] (1 PDB entry) |
Domain d4i3fa1: 4i3f A:1-282 [252585] Other proteins in same PDB: d4i3fa2 automated match to d4lxga_ complexed with cl, na, peg |
PDB Entry: 4i3f (more details), 1.69 Å
SCOPe Domain Sequences for d4i3fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i3fa1 c.69.1.0 (A:1-282) automated matches {Cycloclasticus sp. [TaxId: 385025]} mqtsniqtgsfntflneagtdkdtsilllhgsgpganamsnwqyalpflaenyhclapdi agfglsqhncppngtshwidiwvqqqidlldakgieqthivgnsmgggvtlhllnrhper fkkavlmgpvgapfaptegltkgwefykdpskealeylitkflfdpsllgndiasiaaqr fdnvmkdevrlqfeamfsggtkkgidafvlsddelnnishqmlvtharedffiplnnayy lidripnaqlhvfdhcghwvqiekkkafnnltklffdgmfdd
Timeline for d4i3fa1: