Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.0: automated matches [254214] (1 protein) not a true family |
Protein automated matches [254482] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [255236] (31 PDB entries) |
Domain d4i2ha1: 4i2h A:149-242 [252576] Other proteins in same PDB: d4i2ha2, d4i2ha3 automated match to d1jmsa1 protein/DNA complex; complexed with apc, mg, na, zn |
PDB Entry: 4i2h (more details), 2.75 Å
SCOPe Domain Sequences for d4i2ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i2ha1 a.60.6.0 (A:149-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpitsm kdtegipclgdkvksiiegiiedgesseakavln
Timeline for d4i2ha1: