Lineage for d4i2fa1 (4i2f A:149-242)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329042Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329269Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 2329270Protein automated matches [254482] (3 species)
    not a true protein
  7. 2329289Species Mouse (Mus musculus) [TaxId:10090] [255236] (31 PDB entries)
  8. 2329294Domain d4i2fa1: 4i2f A:149-242 [252570]
    Other proteins in same PDB: d4i2fa2, d4i2fa3
    automated match to d1jmsa1
    protein/DNA complex; complexed with mg, na, zn

Details for d4i2fa1

PDB Entry: 4i2f (more details), 2.1 Å

PDB Description: binary complex of mouse tdt with ssdna
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4i2fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2fa1 a.60.6.0 (A:149-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpitsm
kdtegipclgdkvksiiegiiedgesseakavln

SCOPe Domain Coordinates for d4i2fa1:

Click to download the PDB-style file with coordinates for d4i2fa1.
(The format of our PDB-style files is described here.)

Timeline for d4i2fa1: