| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.0: automated matches [254214] (1 protein) not a true family |
| Protein automated matches [254482] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [255236] (31 PDB entries) |
| Domain d4i2fa1: 4i2f A:149-242 [252570] Other proteins in same PDB: d4i2fa2, d4i2fa3 automated match to d1jmsa1 protein/DNA complex; complexed with mg, na, zn |
PDB Entry: 4i2f (more details), 2.1 Å
SCOPe Domain Sequences for d4i2fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i2fa1 a.60.6.0 (A:149-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpitsm
kdtegipclgdkvksiiegiiedgesseakavln
Timeline for d4i2fa1: