Lineage for d1krt__ (1krt -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229103Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 229104Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 229129Protein Lysyl-tRNA synthetase (LysRS) [50256] (2 species)
  7. 229130Species Escherichia coli, gene lysS [TaxId:562] [50257] (4 PDB entries)
  8. 229134Domain d1krt__: 1krt - [25257]

Details for d1krt__

PDB Entry: 1krt (more details)

PDB Description: solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys

SCOP Domain Sequences for d1krt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krt__ b.40.4.1 (-) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysS}
frrdhtsdqlhaefdgkeneelealnievavagrmmtrrimgkasfvtlqdvggriqlyv
arddlpegvyneqfkkwdlgdilgakgklfktktgelsihctelrlltka

SCOP Domain Coordinates for d1krt__:

Click to download the PDB-style file with coordinates for d1krt__.
(The format of our PDB-style files is described here.)

Timeline for d1krt__: