Lineage for d1krs__ (1krs -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) 
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) 
Protein Lysyl-tRNA synthetase (LysRS) [50256] (2 species) 
Species Escherichia coli, gene lysS [TaxId:562] [50257] (4 PDB entries) 
Domain d1krs__: 1krs - [25256]
Details for d1krs__
PDB Entry: 1krs (more details)
PDB Description: solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys
SCOP Domain Sequences for d1krs__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1krs__ b.40.4.1 (-) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysS}
frrdhtsdqlhaefdgkeneelealnievavagrmmtrrimgkasfvtlqdvggriqlyv
arddlpegvyneqfkkwdlgdilgakgklfktktgelsihctelrlltka
SCOP Domain Coordinates for d1krs__:
Click to download the PDB-style file with coordinates for d1krs__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1krs__:
- d1krs__ first appeared (with stable ids) in SCOP 1.55
- d1krs__ appears in SCOP 1.57
- d1krs__ appears in SCOP 1.61
- d1krs__ appears in the current release, SCOPe 2.08, called d1krsa_
View in 3D