Lineage for d4i2aa3 (4i2a A:303-510)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2563573Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2563815Protein automated matches [254484] (3 species)
    not a true protein
  7. 2563821Species Mouse (Mus musculus) [TaxId:10090] [256295] (28 PDB entries)
  8. 2563822Domain d4i2aa3: 4i2a A:303-510 [252557]
    Other proteins in same PDB: d4i2aa1, d4i2aa2
    automated match to d1jmsa4
    protein/DNA complex; complexed with mg, na

Details for d4i2aa3

PDB Entry: 4i2a (more details), 1.9 Å

PDB Description: binary complex of mouse tdt with ssdna in absence of divalent transition metal ion
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4i2aa3:

Sequence, based on SEQRES records: (download)

>d4i2aa3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhseksgq
qegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtk
rvfleaeseeeifahlgldyiepwerna

Sequence, based on observed residues (ATOM records): (download)

>d4i2aa3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhseksqe
gkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtkrv
fleaeseeeifahlgldyiepwerna

SCOPe Domain Coordinates for d4i2aa3:

Click to download the PDB-style file with coordinates for d4i2aa3.
(The format of our PDB-style files is described here.)

Timeline for d4i2aa3: