| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
| Species Mouse (Mus musculus) [TaxId:10090] [255237] (18 PDB entries) |
| Domain d4i2aa2: 4i2a A:243-302 [252556] Other proteins in same PDB: d4i2aa1, d4i2aa3 automated match to d1jmsa3 protein/DNA complex; complexed with mg, na |
PDB Entry: 4i2a (more details), 1.9 Å
SCOPe Domain Sequences for d4i2aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i2aa2 a.60.12.0 (A:243-302) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc
Timeline for d4i2aa2: