Lineage for d1bbwa1 (1bbw A:11-153)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) 
Protein Lysyl-tRNA synthetase (LysRS) [50256] (2 species) 
Species Escherichia coli, gene lysS [TaxId:562] [50257] (4 PDB entries) 
Domain d1bbwa1: 1bbw A:11-153 [25255]
Other proteins in same PDB: d1bbwa2
Details for d1bbwa1
PDB Entry: 1bbw (more details), 2.7 Å
PDB Description: lysyl-trna synthetase (lyss)
SCOP Domain Sequences for d1bbwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bbwa1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysS}
vvdlnnelktrreklanlreqgiafpndfrrdhtsdqlhaefdgkeneelealnievava
grmmtrrimgkasfvtlqdvggriqlyvarddlpegvyneqfkkwdlgdilgakgklfkt
ktgelsihctelrlltkalrplp
SCOP Domain Coordinates for d1bbwa1:
Click to download the PDB-style file with coordinates for d1bbwa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bbwa1:
- d1bbwa1 appears in SCOP 1.57
- d1bbwa1 appears in the current release, SCOPe 2.08
View in 3D
