Lineage for d4hx8a2 (4hx8 A:63-136)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496027Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1496028Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 1496029Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 1496114Protein automated matches [233398] (2 species)
    not a true protein
  7. 1496122Species Bacillus subtilis [TaxId:224308] [234701] (4 PDB entries)
  8. 1496127Domain d4hx8a2: 4hx8 A:63-136 [252543]
    Other proteins in same PDB: d4hx8a1, d4hx8b1
    automated match to d4hx4a2
    mutant

Details for d4hx8a2

PDB Entry: 4hx8 (more details), 2 Å

PDB Description: Structure of metal-free MNTR mutant E11K
PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d4hx8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hx8a2 a.76.1.1 (A:63-136) automated matches {Bacillus subtilis [TaxId: 224308]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

SCOPe Domain Coordinates for d4hx8a2:

Click to download the PDB-style file with coordinates for d4hx8a2.
(The format of our PDB-style files is described here.)

Timeline for d4hx8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hx8a1