![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
![]() | Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
![]() | Protein automated matches [233398] (2 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [234701] (4 PDB entries) |
![]() | Domain d4hx8a2: 4hx8 A:63-136 [252543] Other proteins in same PDB: d4hx8a1, d4hx8b1 automated match to d4hx4a2 mutant |
PDB Entry: 4hx8 (more details), 2 Å
SCOPe Domain Sequences for d4hx8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx8a2 a.76.1.1 (A:63-136) automated matches {Bacillus subtilis [TaxId: 224308]} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiqkk
Timeline for d4hx8a2: