SCOPe 2.06: Domain d4hx8a1: 4hx8 A:5-62

Lineage for d4hx8a1 (4hx8 A:5-62)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein automated matches [233395] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [234698] (4 PDB entries)

8. Domain d4hx8a1: 4hx8 A:5-62 [252542]
   Other proteins in same PDB: d4hx8a2, d4hx8b2
   automated match to d4hx4a1
   mutant

Details for d4hx8a1

PDB Entry: 4hx8, 2 Å

PDB Description: Structure of metal-free MNTR mutant E11K

PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d4hx8a1:

Sequence; same for both SEQRES and ATOM records:

>d4hx8a1 a.4.5.24 (A:5-62) automated matches {Bacillus subtilis [TaxId: 224308]}
smedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

Timeline for d4hx8a1:

• d4hx8a1 first appeared in SCOPe 2.04
  
• d4hx8a1 appears in SCOPe 2.05
  
• d4hx8a1 appears in SCOPe 2.07
  
• d4hx8a1 appears in the current release, SCOPe 2.08