![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
![]() | Protein automated matches [233395] (2 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [234698] (4 PDB entries) |
![]() | Domain d4hx8a1: 4hx8 A:5-62 [252542] Other proteins in same PDB: d4hx8a2, d4hx8b2 automated match to d4hx4a1 mutant |
PDB Entry: 4hx8 (more details), 2 Å
SCOPe Domain Sequences for d4hx8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx8a1 a.4.5.24 (A:5-62) automated matches {Bacillus subtilis [TaxId: 224308]} smedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl
Timeline for d4hx8a1: