Class a: All alpha proteins [46456] (289 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) automatically mapped to Pfam PF02742 |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
Protein automated matches [233398] (2 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [234701] (4 PDB entries) |
Domain d4hx7b2: 4hx7 B:63-136 [252541] Other proteins in same PDB: d4hx7a1, d4hx7b1 automated match to d4hx4a2 complexed with cd; mutant |
PDB Entry: 4hx7 (more details), 1.9 Å
SCOPe Domain Sequences for d4hx7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx7b2 a.76.1.1 (B:63-136) automated matches {Bacillus subtilis [TaxId: 224308]} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiqkk
Timeline for d4hx7b2: