SCOPe 2.07: Domain d1bbua1: 1bbu A:11-154

Lineage for d1bbua1 (1bbu A:11-154)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Lysyl-tRNA synthetase (LysRS) [50256] (3 species)

7. Species Escherichia coli, gene lysS [TaxId:562] [50257] (4 PDB entries)

8. Domain d1bbua1: 1bbu A:11-154 [25254]
   Other proteins in same PDB: d1bbua2
   protein/RNA complex; complexed with lys

Details for d1bbua1

PDB Entry: 1bbu, 2.7 Å

PDB Description: lysyl-trna synthetase (lyss) complexed with lysine

PDB Compounds: (A:) protein (lysyl-tRNA synthetase)

SCOPe Domain Sequences for d1bbua1:

Sequence; same for both SEQRES and ATOM records:

>d1bbua1 b.40.4.1 (A:11-154) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysS [TaxId: 562]}
vvdlnnelktrreklanlreqgiafpndfrrdhtsdqlhaefdgkeneelealnievava
grmmtrrimgkasfvtlqdvggriqlyvarddlpegvyneqfkkwdlgdilgakgklfkt
ktgelsihctelrlltkalrplpd

Timeline for d1bbua1:

• d1bbua1 first appeared (with stable ids) in SCOP 1.55
  
• d1bbua1 appears in SCOPe 2.06
  
• d1bbua1 appears in the current release, SCOPe 2.08