Lineage for d1bbua1 (1bbu A:11-154)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297374Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 297402Protein Lysyl-tRNA synthetase (LysRS) [50256] (2 species)
  7. 297403Species Escherichia coli, gene lysS [TaxId:562] [50257] (4 PDB entries)
  8. 297404Domain d1bbua1: 1bbu A:11-154 [25254]
    Other proteins in same PDB: d1bbua2
    complexed with lys

Details for d1bbua1

PDB Entry: 1bbu (more details), 2.7 Å

PDB Description: lysyl-trna synthetase (lyss) complexed with lysine

SCOP Domain Sequences for d1bbua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbua1 b.40.4.1 (A:11-154) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysS}
vvdlnnelktrreklanlreqgiafpndfrrdhtsdqlhaefdgkeneelealnievava
grmmtrrimgkasfvtlqdvggriqlyvarddlpegvyneqfkkwdlgdilgakgklfkt
ktgelsihctelrlltkalrplpd

SCOP Domain Coordinates for d1bbua1:

Click to download the PDB-style file with coordinates for d1bbua1.
(The format of our PDB-style files is described here.)

Timeline for d1bbua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bbua2