Lineage for d4hx6g_ (4hx6 G:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055435Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2055436Protein automated matches [190439] (20 species)
    not a true protein
  7. 2055484Species Streptomyces globisporus [TaxId:1908] [256294] (2 PDB entries)
  8. 2055491Domain d4hx6g_: 4hx6 G: [252536]
    Other proteins in same PDB: d4hx6a2, d4hx6c2, d4hx6d2, d4hx6f2
    automated match to d3pfta_
    complexed with act, so4

Details for d4hx6g_

PDB Entry: 4hx6 (more details), 1.89 Å

PDB Description: streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6
PDB Compounds: (G:) Oxidoreductase

SCOPe Domain Sequences for d4hx6g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hx6g_ b.45.1.0 (G:) automated matches {Streptomyces globisporus [TaxId: 1908]}
ppaelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvlicvgkd
avmhqrltalptfavsvleagqekaarhfadhshppgvdqfdtvdwvlgeesgapliaga
vahlecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapd

SCOPe Domain Coordinates for d4hx6g_:

Click to download the PDB-style file with coordinates for d4hx6g_.
(The format of our PDB-style files is described here.)

Timeline for d4hx6g_: