SCOPe 2.04: Domain d4hx6b_: 4hx6 B:

Lineage for d4hx6b_ (4hx6 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (16 species)
   not a true protein

7. Species Streptomyces globisporus [TaxId:1908] [256294] (2 PDB entries)

8. Domain d4hx6b_: 4hx6 B: [252535]
   automated match to d3pfta_
   complexed with act, so4

Details for d4hx6b_

PDB Entry: 4hx6, 1.89 Å

PDB Description: streptomyces globisporus c-1027 nadh:fad oxidoreductase sgce6

PDB Compounds: (B:) Oxidoreductase

SCOPe Domain Sequences for d4hx6b_:

Sequence, based on SEQRES records:

>d4hx6b_ b.45.1.0 (B:) automated matches {Streptomyces globisporus [TaxId: 1908]}
paelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvlicvgkda
vmhqrltalptfavsvleagqekaarhfadhshppgvdqfdtvdwvlgeesgapliagav
ahlecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapda

Sequence, based on observed residues (ATOM records):

>d4hx6b_ b.45.1.0 (B:) automated matches {Streptomyces globisporus [TaxId: 1908]}
paelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvlicvgkda
vmhqrltalptfavsvleagqekaarhfashppgvdqfdtvdwvlgeesgapliagavah
lecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapda

Timeline for d4hx6b_:

• d4hx6b_ is new in SCOPe 2.04-stable
  
• d4hx6b_ appears in SCOPe 2.05
  
• d4hx6b_ appears in the current release, SCOPe 2.08