Class b: All beta proteins [48724] (176 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (16 species) not a true protein |
Species Streptomyces globisporus [TaxId:1908] [256294] (2 PDB entries) |
Domain d4hx6b_: 4hx6 B: [252535] automated match to d3pfta_ complexed with act, so4 |
PDB Entry: 4hx6 (more details), 1.89 Å
SCOPe Domain Sequences for d4hx6b_:
Sequence, based on SEQRES records: (download)
>d4hx6b_ b.45.1.0 (B:) automated matches {Streptomyces globisporus [TaxId: 1908]} paelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvlicvgkda vmhqrltalptfavsvleagqekaarhfadhshppgvdqfdtvdwvlgeesgapliagav ahlecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapda
>d4hx6b_ b.45.1.0 (B:) automated matches {Streptomyces globisporus [TaxId: 1908]} paelvdpkdrvqlrrvfgdfptgvtvvtvggseprgmtansftsvslspplvlicvgkda vmhqrltalptfavsvleagqekaarhfashppgvdqfdtvdwvlgeesgapliagavah lecaihrlyeggdhtiflgevitatrwparegmlfsggrfrrfapda
Timeline for d4hx6b_: