Lineage for d4hwya_ (4hwy A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155423Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2155424Protein automated matches [190230] (20 species)
    not a true protein
  7. 2155536Species Trypanosoma brucei [TaxId:999953] [256293] (1 PDB entry)
  8. 2155537Domain d4hwya_: 4hwy A: [252534]
    automated match to d3pbha_

Details for d4hwya_

PDB Entry: 4hwy (more details), 2.1 Å

PDB Description: trypanosoma brucei procathepsin b solved from 40 fs free-electron laser pulse data by serial femtosecond x-ray crystallography
PDB Compounds: (A:) Cysteine peptidase C (CPC)

SCOPe Domain Sequences for d4hwya_:

Sequence, based on SEQRES records: (download)

>d4hwya_ d.3.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
edapvlskafvdrvnrlnrgiwkakydgvmqnitlreakrlngvikknnnasilpkrrft
eeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfctmggvqdvhi
sagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhskskngyppcs
qfnfdtpkcnytcddptipvvnyrswtsyalqgeddymrelffrgpfevafdvyedfiay
nsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflirrgssecgie
dggsagiplapnta

Sequence, based on observed residues (ATOM records): (download)

>d4hwya_ d.3.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
edapvlskafvdrvnrlnrgiwkakydgvmqnitlreakrlngvikilpkrrfteeeara
plpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfctmggvqdvhisagdll
accsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhskskngyppcsqfnfdt
pkcnytcddptipvvnyrswtsyalqgeddymrelffrgpfevafdvyedfiaynsgvyh
hvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflirrgssecgiedggsag
iplapnta

SCOPe Domain Coordinates for d4hwya_:

Click to download the PDB-style file with coordinates for d4hwya_.
(The format of our PDB-style files is described here.)

Timeline for d4hwya_: