SCOP 1.67: Domain d1efwb1: 1efw B:1-104

Lineage for d1efwb1 (1efw B:1-104)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
   this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes

7. Species Thermus thermophilus, AspRS-1 [TaxId:274] [50255] (3 PDB entries)

8. Domain d1efwb1: 1efw B:1-104 [25253]
   Other proteins in same PDB: d1efwa2, d1efwa3, d1efwb2, d1efwb3
   protein/RNA complex; complexed with 2ma, 4su, 5mu, g7m, h2u, psu, quo

Details for d1efwb1

PDB Entry: 1efw, 3 Å

PDB Description: Crystal structure of aspartyl-tRNA synthetase from Thermus thermophilus complexed to tRNAasp from Escherichia coli

SCOP Domain Sequences for d1efwb1:

Sequence; same for both SEQRES and ATOM records:

>d1efwb1 b.40.4.1 (B:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1}
mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak

Timeline for d1efwb1:

• d1efwb1 first appeared (with stable ids) in SCOP 1.55
  
• d1efwb1 appears in SCOP 1.65
  
• d1efwb1 appears in SCOP 1.69
  
• d1efwb1 appears in the current release, SCOPe 2.08