| Class b: All beta proteins [48724] (141 folds) |
| Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) ![]() |
| Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
| Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species) this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes |
| Species Thermus thermophilus, AspRS-1 [TaxId:274] [50255] (3 PDB entries) |
| Domain d1efwb1: 1efw B:1-104 [25253] Other proteins in same PDB: d1efwa2, d1efwa3, d1efwb2, d1efwb3 protein/RNA complex; complexed with 2ma, 4su, 5mu, g7m, h2u, psu, quo |
PDB Entry: 1efw (more details), 3 Å
SCOP Domain Sequences for d1efwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efwb1 b.40.4.1 (B:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1}
mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak
Timeline for d1efwb1: