Lineage for d4hv5b1 (4hv5 B:4-62)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693576Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2693661Protein automated matches [233395] (2 species)
    not a true protein
  7. 2693669Species Bacillus subtilis [TaxId:224308] [234698] (4 PDB entries)
  8. 2693673Domain d4hv5b1: 4hv5 B:4-62 [252526]
    Other proteins in same PDB: d4hv5a2, d4hv5b2
    automated match to d3r60a1
    complexed with epe, fe2

Details for d4hv5b1

PDB Entry: 4hv5 (more details), 1.9 Å

PDB Description: Structure of the MNTR FE2+ complex with E site metal binding
PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d4hv5b1:

Sequence, based on SEQRES records: (download)

>d4hv5b1 a.4.5.24 (B:4-62) automated matches {Bacillus subtilis [TaxId: 224308]}
psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

Sequence, based on observed residues (ATOM records): (download)

>d4hv5b1 a.4.5.24 (B:4-62) automated matches {Bacillus subtilis [TaxId: 224308]}
psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyglvl

SCOPe Domain Coordinates for d4hv5b1:

Click to download the PDB-style file with coordinates for d4hv5b1.
(The format of our PDB-style files is described here.)

Timeline for d4hv5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hv5b2