Lineage for d4hv4b2 (4hv4 B:108-322)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872415Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1872909Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 1872964Family c.72.2.0: automated matches [254328] (1 protein)
    not a true family
  6. 1872965Protein automated matches [254749] (2 species)
    not a true protein
  7. 1872970Species Yersinia pestis [TaxId:214092] [256291] (1 PDB entry)
  8. 1872972Domain d4hv4b2: 4hv4 B:108-322 [252522]
    Other proteins in same PDB: d4hv4a1, d4hv4a3, d4hv4b1, d4hv4b3
    automated match to d1p3da3
    complexed with amp, bme

Details for d4hv4b2

PDB Entry: 4hv4 (more details), 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of udp-n-acetylmuramate--l- alanine ligase (murc) from yersinia pestis co92 in complex with amp
PDB Compounds: (B:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d4hv4b2:

Sequence, based on SEQRES records: (download)

>d4hv4b2 c.72.2.0 (B:108-322) automated matches {Yersinia pestis [TaxId: 214092]}
raemlaelmryrhgiavagthgkttttamlssiyaeagldptfvngglvkaagtharlgs
sryliaeadesdasflhlqpmvaivtnieadhmdtyqgdfenlkqtfinflhnlpfygra
vmciddpvvrellprvgrhittygfsddadvqiasyrqegpqghftlrrqdkplievtln
apgrhnalnaaaavavateegiededilralvgfq

Sequence, based on observed residues (ATOM records): (download)

>d4hv4b2 c.72.2.0 (B:108-322) automated matches {Yersinia pestis [TaxId: 214092]}
raemlaelmryrhgiavagthgkttttamlssiyaeagldptfvngglvkaagtharlgs
sryliaeadesdasflhlqpmvaivtnieaddfenlkqtfinflhnlpfygravmciddp
vvrellprvgrhittygfsddadvqiasyrqegpqghftlrrqdkplievtlnapgrhna
lnaaaavavateegiededilralvgfq

SCOPe Domain Coordinates for d4hv4b2:

Click to download the PDB-style file with coordinates for d4hv4b2.
(The format of our PDB-style files is described here.)

Timeline for d4hv4b2: