Lineage for d4hv4b1 (4hv4 B:15-107)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2110359Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2110360Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2110383Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 2110384Protein automated matches [254548] (5 species)
    not a true protein
  7. 2110408Species Yersinia pestis [TaxId:214092] [256290] (1 PDB entry)
  8. 2110410Domain d4hv4b1: 4hv4 B:15-107 [252521]
    Other proteins in same PDB: d4hv4a2, d4hv4a3, d4hv4b2, d4hv4b3
    automated match to d1gqqa1
    complexed with amp, bme

Details for d4hv4b1

PDB Entry: 4hv4 (more details), 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of udp-n-acetylmuramate--l- alanine ligase (murc) from yersinia pestis co92 in complex with amp
PDB Compounds: (B:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d4hv4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hv4b1 c.5.1.0 (B:15-107) automated matches {Yersinia pestis [TaxId: 214092]}
emrrvrhihfvgiggagmggiaevlanegyqisgsdlapnsvtqhltalgaqiyfhhrpe
nvldasvvvvstaisadnpeivaarearipvir

SCOPe Domain Coordinates for d4hv4b1:

Click to download the PDB-style file with coordinates for d4hv4b1.
(The format of our PDB-style files is described here.)

Timeline for d4hv4b1: