![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
![]() | Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) ![]() |
![]() | Family c.59.1.0: automated matches [254241] (1 protein) not a true family |
![]() | Protein automated matches [254550] (5 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [256292] (1 PDB entry) |
![]() | Domain d4hv4a3: 4hv4 A:323-483 [252520] Other proteins in same PDB: d4hv4a1, d4hv4a2, d4hv4b1, d4hv4b2 automated match to d1gqya2 complexed with amp, bme |
PDB Entry: 4hv4 (more details), 2.25 Å
SCOPe Domain Sequences for d4hv4a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hv4a3 c.59.1.0 (A:323-483) automated matches {Yersinia pestis [TaxId: 214092]} gtgrrfdflgnfplapvngkegsamlvddyghhptevdatikaaragwpdkrivmlfqph rytrtrdlyddfanvlsqvdvllmldvyaageppipgadsralcrtirnrgkldpilvpd sesapemlaqilngedlilvqgagnigkiarklaehklqpq
Timeline for d4hv4a3: