SCOPe 2.04: Domain d4huwg2: 4huw G:182-277

Lineage for d4huwg2 (4huw G:182-277)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
   Uniprot P01901 22-299

8. Domain d4huwg2: 4huw G:182-277 [252516]
   Other proteins in same PDB: d4huwa1, d4huwb_, d4huwc1, d4huwd_, d4huwe1, d4huwf_, d4huwg1, d4huwh_
   automated match to d1fo0h1
   complexed with so4

Details for d4huwg2

PDB Entry: 4huw, 3.16 Å

PDB Description: crystal structure of h2db-npm6t

PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4huwg2:

Sequence; same for both SEQRES and ATOM records:

>d4huwg2 b.1.1.2 (G:182-277) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwepp

Timeline for d4huwg2:

• d4huwg2 is new in SCOPe 2.04-stable
  
• d4huwg2 appears in SCOPe 2.05
  
• d4huwg2 appears in the current release, SCOPe 2.08