SCOPe 2.02: Domain d1g51b1: 1g51 B:1001-1104

Lineage for d1g51b1 (1g51 B:1001-1104)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
   this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes

7. Species Thermus thermophilus, AspRS-1 [TaxId:274] [50255] (3 PDB entries)

8. Domain d1g51b1: 1g51 B:1001-1104 [25251]
   Other proteins in same PDB: d1g51a2, d1g51a3, d1g51b2, d1g51b3
   complexed with amo, amp, so4

Details for d1g51b1

PDB Entry: 1g51, 2.4 Å

PDB Description: aspartyl trna synthetase from thermus thermophilus at 2.4 a resolution

PDB Compounds: (B:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1g51b1:

Sequence; same for both SEQRES and ATOM records:

>d1g51b1 b.40.4.1 (B:1001-1104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]}
mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak

Timeline for d1g51b1:

• d1g51b1 first appeared (with stable ids) in SCOP 1.55
  
• d1g51b1 appears in SCOPe 2.01
  
• d1g51b1 appears in SCOPe 2.03
  
• d1g51b1 appears in the current release, SCOPe 2.08