Class b: All beta proteins [48724] (141 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) |
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species) this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes |
Species Thermus thermophilus, AspRS-1 [TaxId:274] [50255] (3 PDB entries) |
Domain d1g51b1: 1g51 B:1001-1104 [25251] Other proteins in same PDB: d1g51a2, d1g51a3, d1g51b2, d1g51b3 complexed with amo, amp, so4 |
PDB Entry: 1g51 (more details), 2.4 Å
SCOP Domain Sequences for d1g51b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g51b1 b.40.4.1 (B:1001-1104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1} mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak
Timeline for d1g51b1: