Lineage for d4htra3 (4htr A:346-425)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955424Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955515Family d.58.36.0: automated matches [254283] (1 protein)
    not a true family
  6. 2955516Protein automated matches [254662] (3 species)
    not a true protein
  7. 2955517Species Escherichia coli K-12 [TaxId:83333] [256262] (3 PDB entries)
  8. 2955521Domain d4htra3: 4htr A:346-425 [252504]
    Other proteins in same PDB: d4htra2, d4htra4
    automated match to d1aopa2
    complexed with na, sf4, so3, srm

Details for d4htra3

PDB Entry: 4htr (more details), 1.6 Å

PDB Description: n149w variant of sirhp bound to sulfite
PDB Compounds: (A:) Sulfite reductase [NADPH] hemoprotein beta-component

SCOPe Domain Sequences for d4htra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4htra3 d.58.36.0 (A:346-425) automated matches {Escherichia coli K-12 [TaxId: 83333]}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt

SCOPe Domain Coordinates for d4htra3:

Click to download the PDB-style file with coordinates for d4htra3.
(The format of our PDB-style files is described here.)

Timeline for d4htra3: