| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) ![]() duplication: contains two subdomains of this fold |
| Family d.58.36.0: automated matches [254283] (1 protein) not a true family |
| Protein automated matches [254662] (3 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [256262] (3 PDB entries) |
| Domain d4htra3: 4htr A:346-425 [252504] Other proteins in same PDB: d4htra2, d4htra4 automated match to d1aopa2 complexed with na, sf4, so3, srm |
PDB Entry: 4htr (more details), 1.6 Å
SCOPe Domain Sequences for d4htra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4htra3 d.58.36.0 (A:346-425) automated matches {Escherichia coli K-12 [TaxId: 83333]}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt
Timeline for d4htra3: