Lineage for d4htra2 (4htr A:151-345)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977656Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2977657Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2977743Family d.134.1.0: automated matches [254284] (1 protein)
    not a true family
  6. 2977744Protein automated matches [254663] (3 species)
    not a true protein
  7. 2977745Species Escherichia coli K-12 [TaxId:83333] [256263] (3 PDB entries)
  8. 2977748Domain d4htra2: 4htr A:151-345 [252503]
    Other proteins in same PDB: d4htra1, d4htra3
    automated match to d1aopa3
    complexed with na, sf4, so3, srm

Details for d4htra2

PDB Entry: 4htr (more details), 1.6 Å

PDB Description: n149w variant of sirhp bound to sulfite
PDB Compounds: (A:) Sulfite reductase [NADPH] hemoprotein beta-component

SCOPe Domain Sequences for d4htra2:

Sequence, based on SEQRES records: (download)

>d4htra2 d.134.1.0 (A:151-345) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnrnvlctsnpyesqlhaeayewakkisehllprtrayaeiwldqekvattdeepilgqt
ylprkfkttvvippqndidlhandmnfvaiaengklvgfnllvggglsiehgnkktyart
asefgylplehtlavaeavvttqrdwgnrtdrknaktkytlervgvetfkaeverragik
fepirpyeftgrgdr

Sequence, based on observed residues (ATOM records): (download)

>d4htra2 d.134.1.0 (A:151-345) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnrnvlctsnpyesqlhaeayewakkisehllpkfkttvvippqndidlhandmnfvaia
engklvgfnllvggglsiehgnkktyartasefgylplehtlavaeavvttqrdwgnnak
tkytlervgvetfkaeverragikfepirpyeftgrgdr

SCOPe Domain Coordinates for d4htra2:

Click to download the PDB-style file with coordinates for d4htra2.
(The format of our PDB-style files is described here.)

Timeline for d4htra2: