Lineage for d1g51a1 (1g51 A:1-104)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374538Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 374539Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. 374556Species Thermus thermophilus, AspRS-1 [TaxId:274] [50255] (3 PDB entries)
  8. 374559Domain d1g51a1: 1g51 A:1-104 [25250]
    Other proteins in same PDB: d1g51a2, d1g51a3, d1g51b2, d1g51b3

Details for d1g51a1

PDB Entry: 1g51 (more details), 2.4 Å

PDB Description: aspartyl trna synthetase from thermus thermophilus at 2.4 a resolution

SCOP Domain Sequences for d1g51a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g51a1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1}
mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak

SCOP Domain Coordinates for d1g51a1:

Click to download the PDB-style file with coordinates for d1g51a1.
(The format of our PDB-style files is described here.)

Timeline for d1g51a1: