SCOP 1.57: Domain d1g51a1: 1g51 A:1-104

Lineage for d1g51a1 (1g51 A:1-104)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)

7. Species Thermus thermophilus [TaxId:274] [50255] (2 PDB entries)

8. Domain d1g51a1: 1g51 A:1-104 [25250]
   Other proteins in same PDB: d1g51a2, d1g51a3, d1g51b2, d1g51b3

Details for d1g51a1

PDB Entry: 1g51, 2.4 Å

PDB Description: aspartyl trna synthetase from thermus thermophilus at 2.4 a resolution

SCOP Domain Sequences for d1g51a1:

Sequence; same for both SEQRES and ATOM records:

>d1g51a1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus}
mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak

Timeline for d1g51a1:

• d1g51a1 first appeared (with stable ids) in SCOP 1.55
  
• d1g51a1 appears in SCOP 1.59
  
• d1g51a1 appears in the current release, SCOPe 2.08