Lineage for d4hs7a_ (4hs7 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164258Species Staphylococcus aureus [TaxId:93061] [256289] (2 PDB entries)
  8. 2164261Domain d4hs7a_: 4hs7 A: [252494]
    automated match to d3w15c_
    complexed with k, p33, peg

Details for d4hs7a_

PDB Entry: 4hs7 (more details), 2.6 Å

PDB Description: 2.6 angstrom structure of the extracellular solute-binding protein from staphylococcus aureus in complex with peg.
PDB Compounds: (A:) Bacterial extracellular solute-binding protein, putative

SCOPe Domain Sequences for d4hs7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hs7a_ c.94.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93061]}
kdkpnqltmwvdgdkqmafykkitdqytkktgikvklvnigqndqlenisldapagkgpd
ifflahdntgsaylqglaaeiklskdelkgfnkqalkamnydnkqlalpaivettalfyn
kklvknapqtleeveanaakltdskkkqygmlfdaknfyfnypflfgnddyifkkngsey
dihqlglnskhvvknaerlqkwydkgylpkaathdvmiglfkegkvgqfvtgpwnineyq
etfgkdlgvttlptdggkpmkpflgvrgwylseyskhkywakdlmlyitskdtlqkytde
mseitgrvdvkssnpnlkvfekqarhaepmpnipemrqvwepmgnasifisngknpkqal
deatnditqnikilhp

SCOPe Domain Coordinates for d4hs7a_:

Click to download the PDB-style file with coordinates for d4hs7a_.
(The format of our PDB-style files is described here.)

Timeline for d4hs7a_: