Lineage for d1eqrc1 (1eqr C:1-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1788690Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1788691Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. 1788698Species Escherichia coli [TaxId:562] [50254] (3 PDB entries)
  8. 1788704Domain d1eqrc1: 1eqr C:1-106 [25249]
    Other proteins in same PDB: d1eqra2, d1eqra3, d1eqrb2, d1eqrb3, d1eqrc2, d1eqrc3
    complexed with mg

Details for d1eqrc1

PDB Entry: 1eqr (more details), 2.7 Å

PDB Description: crystal structure of free aspartyl-trna synthetase from escherichia coli
PDB Compounds: (C:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1eqrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqrc1 b.40.4.1 (C:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]}
mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
selrnefciqvtgtvrardekninrdmatgeievlassltiinrad

SCOPe Domain Coordinates for d1eqrc1:

Click to download the PDB-style file with coordinates for d1eqrc1.
(The format of our PDB-style files is described here.)

Timeline for d1eqrc1: