![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
![]() | Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species) this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes |
![]() | Species Escherichia coli [TaxId:562] [50254] (3 PDB entries) |
![]() | Domain d1eqrc1: 1eqr C:1-106 [25249] Other proteins in same PDB: d1eqra2, d1eqra3, d1eqrb2, d1eqrb3, d1eqrc2, d1eqrc3 complexed with mg |
PDB Entry: 1eqr (more details), 2.7 Å
SCOPe Domain Sequences for d1eqrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqrc1 b.40.4.1 (C:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla selrnefciqvtgtvrardekninrdmatgeievlassltiinrad
Timeline for d1eqrc1: