Lineage for d4hpna2 (4hpn A:124-378)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1573854Species Agrobacterium tumefaciens [TaxId:176299] [256273] (2 PDB entries)
  8. 1573855Domain d4hpna2: 4hpn A:124-378 [252482]
    Other proteins in same PDB: d4hpna1
    automated match to d3sjna2
    complexed with ca, imd, ni

Details for d4hpna2

PDB Entry: 4hpn (more details), 1.6 Å

PDB Description: crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d4hpna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hpna2 c.1.11.0 (A:124-378) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
rwresvrayatgsfkrdnvdrvsdnasemaerraegfhackikigfgveedlrviaavre
aigpdmrlmidanhgytvteaitlgdraagfgidwfeepvvpeqldayarvragqpipva
ggetwhgrygmwqalsagavdilqpdlcgcggfseiqkiatlatlhgvrivphvwgtgvq
iaaalqfmaamtpdpvrvnpiepimefdrthnpfrqavlrepleavngvvtipdgpglgi
einrdaltefrmpdp

SCOPe Domain Coordinates for d4hpna2:

Click to download the PDB-style file with coordinates for d4hpna2.
(The format of our PDB-style files is described here.)

Timeline for d4hpna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hpna1