Lineage for d4hooa_ (4hoo A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071116Family b.82.2.14: Histone demethylase core [254153] (4 protein domains)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
  6. 2071173Protein JMJD2D core [254343] (1 species)
  7. 2071174Species Human (Homo sapiens) [TaxId:9606] [254776] (8 PDB entries)
  8. 2071176Domain d4hooa_: 4hoo A: [252476]
    automated match to d3dxua_
    complexed with act, ni, zn

Details for d4hooa_

PDB Entry: 4hoo (more details), 2.5 Å

PDB Description: crystal structure of human jmjd2d/kdm4d apoenzyme
PDB Compounds: (A:) Lysine-specific demethylase 4D

SCOPe Domain Sequences for d4hooa_:

Sequence, based on SEQRES records: (download)

>d4hooa_ b.82.2.14 (A:) JMJD2D core {Human (Homo sapiens) [TaxId: 9606]}
qnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseili
atplqqvasgragvftqyhkkaaamtvgeyrhlanskkyqtpphqnfedlerkywknriy
nspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfaw
htedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalisp
tvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqcs
cgearvtfsmdafvrilqperydlwkrgqd

Sequence, based on observed residues (ATOM records): (download)

>d4hooa_ b.82.2.14 (A:) JMJD2D core {Human (Homo sapiens) [TaxId: 9606]}
qnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseili
atplqqvasgragvftqyhkkaaamtvgeyrhlanskkyqtpphqnfedlerkywknriy
nspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfaw
htedmdlysinylhlgepktwyvvppehgqrlerlarelfpgscgaflrhkvalisptvl
kengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqcscge
arvtfsmdafvrilqperydlwkrgqd

SCOPe Domain Coordinates for d4hooa_:

Click to download the PDB-style file with coordinates for d4hooa_.
(The format of our PDB-style files is described here.)

Timeline for d4hooa_: