Lineage for d4hnak_ (4hna K:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1595736Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. 1595877Protein automated matches [190129] (6 species)
    not a true protein
  7. 1595886Species Human (Homo sapiens) [TaxId:9606] [187145] (31 PDB entries)
  8. 1595945Domain d4hnak_: 4hna K: [252474]
    Other proteins in same PDB: d4hnaa1, d4hnaa2, d4hnab1, d4hnab2, d4hnad_
    automated match to d1mkja_
    complexed with adp, alf, gdp, gtp, mg

Details for d4hnak_

PDB Entry: 4hna (more details), 3.19 Å

PDB Description: kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin
PDB Compounds: (K:) kinesin-1 heavy chain

SCOPe Domain Sequences for d4hnak_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hnak_ c.37.1.9 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aesnikvmcrfrplnesevnrgdkyiakfqgedtvviaskpyafdrvfqsstsqeqvynd
aakkivkdvlegyngtifaygqtssgkthtmegklhdpegmgiiprivqdifnyiysmde
nlefhikvsyfeiyldkirdlldvsktnlsvhedknrvpyvkgaterfvsspdevmdtid
egksnrhvavtnmnehssrshsiflinvkqentqteqklsgklylvdlagsekvsktgae
gavldeakninkslsalgnvisalaegstyvpyrdskmtrilqdslggnarttiviccsp
ssynesetkstllfgqraktikntvsvnvelta

SCOPe Domain Coordinates for d4hnak_:

Click to download the PDB-style file with coordinates for d4hnak_.
(The format of our PDB-style files is described here.)

Timeline for d4hnak_: