SCOPe 2.04: Domain d4hnak_: 4hna K:

Lineage for d4hnak_ (4hna K:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.9: Motor proteins [52641] (5 proteins)

6. Protein automated matches [190129] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187145] (31 PDB entries)

8. Domain d4hnak_: 4hna K: [252474]
   Other proteins in same PDB: d4hnaa1, d4hnaa2, d4hnab1, d4hnab2, d4hnad_
   automated match to d1mkja_
   complexed with adp, alf, gdp, gtp, mg

Details for d4hnak_

PDB Entry: 4hna, 3.19 Å

PDB Description: kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin

PDB Compounds: (K:) kinesin-1 heavy chain

SCOPe Domain Sequences for d4hnak_:

Sequence; same for both SEQRES and ATOM records:

>d4hnak_ c.37.1.9 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aesnikvmcrfrplnesevnrgdkyiakfqgedtvviaskpyafdrvfqsstsqeqvynd
aakkivkdvlegyngtifaygqtssgkthtmegklhdpegmgiiprivqdifnyiysmde
nlefhikvsyfeiyldkirdlldvsktnlsvhedknrvpyvkgaterfvsspdevmdtid
egksnrhvavtnmnehssrshsiflinvkqentqteqklsgklylvdlagsekvsktgae
gavldeakninkslsalgnvisalaegstyvpyrdskmtrilqdslggnarttiviccsp
ssynesetkstllfgqraktikntvsvnvelta

Timeline for d4hnak_:

• d4hnak_ is new in SCOPe 2.04-stable
  
• d4hnak_ appears in SCOPe 2.05
  
• d4hnak_ appears in the current release, SCOPe 2.08