SCOPe 2.07: Domain d4hnad1: 4hna D:13-169

Lineage for d4hnad1 (4hna D:13-169)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (8 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [194542] (2 PDB entries)

8. Domain d4hnad1: 4hna D:13-169 [252473]
   Other proteins in same PDB: d4hnaa1, d4hnaa2, d4hnab1, d4hnab2, d4hnad2, d4hnak_
   automated match to d1mx4b_
   complexed with adp, alf, gdp, gtp, mg

Details for d4hnad1

PDB Entry: 4hna, 3.19 Å

PDB Description: kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin

PDB Compounds: (D:) Designed ankyrin repeat protein (DARPIN) D2

SCOPe Domain Sequences for d4hnad1:

Sequence; same for both SEQRES and ATOM records:

>d4hnad1 d.211.1.0 (D:13-169) automated matches {Artificial gene [TaxId: 32630]}
dlgkklleaaragqddevrilmangadvnaeddsgktplhlaaikghleivevllkhgad
vnaadkmgdtplhlaalyghleivevllkngadvnatdtygftplhlaadaghleivevl
lkygadvnaqdkfgktafdisidngnedlaeilqkln

Timeline for d4hnad1:

• d4hnad1 first appeared in SCOPe 2.04, called d4hnad_
  
• d4hnad1 appears in SCOPe 2.06
  
• d4hnad1 appears in the current release, SCOPe 2.08