Lineage for d4hnad1 (4hna D:13-169)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006665Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 3006666Protein automated matches [191267] (8 species)
    not a true protein
  7. 3006672Species Artificial gene [TaxId:32630] [194542] (2 PDB entries)
  8. 3006675Domain d4hnad1: 4hna D:13-169 [252473]
    Other proteins in same PDB: d4hnaa1, d4hnaa2, d4hnab1, d4hnab2, d4hnad2, d4hnak_
    automated match to d1mx4b_
    complexed with adp, alf, gdp, gtp, mg

Details for d4hnad1

PDB Entry: 4hna (more details), 3.19 Å

PDB Description: kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin
PDB Compounds: (D:) Designed ankyrin repeat protein (DARPIN) D2

SCOPe Domain Sequences for d4hnad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hnad1 d.211.1.0 (D:13-169) automated matches {Artificial gene [TaxId: 32630]}
dlgkklleaaragqddevrilmangadvnaeddsgktplhlaaikghleivevllkhgad
vnaadkmgdtplhlaalyghleivevllkngadvnatdtygftplhlaadaghleivevl
lkygadvnaqdkfgktafdisidngnedlaeilqkln

SCOPe Domain Coordinates for d4hnad1:

Click to download the PDB-style file with coordinates for d4hnad1.
(The format of our PDB-style files is described here.)

Timeline for d4hnad1: