Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [226224] (26 PDB entries) |
Domain d4hnab2: 4hna B:246-441 [252472] Other proteins in same PDB: d4hnaa1, d4hnab1, d4hnad1, d4hnad2, d4hnak_ automated match to d3rycd2 complexed with adp, alf, gdp, gtp, mg |
PDB Entry: 4hna (more details), 3.19 Å
SCOPe Domain Sequences for d4hnab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hnab2 d.79.2.1 (B:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
Timeline for d4hnab2: