Lineage for d4hnab2 (4hna B:246-441)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1657767Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1657768Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1657875Protein automated matches [227071] (2 species)
    not a true protein
  7. 1657931Species Sheep (Ovis aries) [TaxId:9940] [226224] (9 PDB entries)
  8. 1657961Domain d4hnab2: 4hna B:246-441 [252472]
    Other proteins in same PDB: d4hnaa1, d4hnab1, d4hnad_, d4hnak_
    automated match to d3rycd2
    complexed with adp, alf, gdp, gtp, mg

Details for d4hnab2

PDB Entry: 4hna (more details), 3.19 Å

PDB Description: kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4hnab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hnab2 d.79.2.1 (B:246-441) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d4hnab2:

Click to download the PDB-style file with coordinates for d4hnab2.
(The format of our PDB-style files is described here.)

Timeline for d4hnab2: