SCOPe 2.04: Domain d4hnaa2: 4hna A:246-437

Lineage for d4hnaa2 (4hna A:246-437)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (2 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (9 PDB entries)

8. Domain d4hnaa2: 4hna A:246-437 [252470]
   Other proteins in same PDB: d4hnaa1, d4hnab1, d4hnad_, d4hnak_
   automated match to d4i50a2
   complexed with adp, alf, gdp, gtp, mg

Details for d4hnaa2

PDB Entry: 4hna, 3.19 Å

PDB Description: kinesin motor domain in the adp-mg-alfx state in complex with tubulin and a darpin

PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d4hnaa2:

Sequence; same for both SEQRES and ATOM records:

>d4hnaa2 d.79.2.1 (A:246-437) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Timeline for d4hnaa2:

• d4hnaa2 is new in SCOPe 2.04-stable
  
• d4hnaa2 appears in SCOPe 2.05
  
• d4hnaa2 appears in the current release, SCOPe 2.08