Lineage for d1eqra1 (1eqr A:1-106)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14053Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
  6. 14054Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)
  7. 14061Species Escherichia coli [TaxId:562] [50254] (2 PDB entries)
  8. 14063Domain d1eqra1: 1eqr A:1-106 [25247]
    Other proteins in same PDB: d1eqra2, d1eqra3, d1eqrb2, d1eqrb3, d1eqrc2, d1eqrc3

Details for d1eqra1

PDB Entry: 1eqr (more details), 2.7 Å

PDB Description: crystal structure of free aspartyl-trna synthetase from escherichia coli
PDB Compounds: (A:)

SCOP Domain Sequences for d1eqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqra1 b.40.4.1 (A:1-106) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli}
mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
selrnefciqvtgtvrardekninrdmatgeievlassltiinrad

SCOP Domain Coordinates for d1eqra1:

Click to download the PDB-style file with coordinates for d1eqra1.
(The format of our PDB-style files is described here.)

Timeline for d1eqra1: