Lineage for d4hlea3 (4hle A:528-725)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726152Domain d4hlea3: 4hle A:528-725 [252465]
    Other proteins in same PDB: d4hlea1, d4hlea2, d4hlea4
    automated match to d1e7ua1
    complexed with 17v

Details for d4hlea3

PDB Entry: 4hle (more details), 2.78 Å

PDB Description: Compound 21 (1-alkyl-substituted 1,2,4-triazoles)
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4hlea3:

Sequence, based on SEQRES records: (download)

>d4hlea3 a.118.1.0 (A:528-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpk
aypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqk
lesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsr
hyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d4hlea3 a.118.1.0 (A:528-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alpkempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqq
eivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyll
qlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileayl
rgcg

SCOPe Domain Coordinates for d4hlea3:

Click to download the PDB-style file with coordinates for d4hlea3.
(The format of our PDB-style files is described here.)

Timeline for d4hlea3: