Lineage for d4hlea2 (4hle A:353-521)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038265Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2038266Protein automated matches [190497] (4 species)
    not a true protein
  7. 2038269Species Human (Homo sapiens) [TaxId:9606] [188711] (22 PDB entries)
  8. 2038285Domain d4hlea2: 4hle A:353-521 [252464]
    Other proteins in same PDB: d4hlea1, d4hlea3, d4hlea4
    automated match to d1e8wa2
    complexed with 17v

Details for d4hlea2

PDB Entry: 4hle (more details), 2.78 Å

PDB Description: Compound 21 (1-alkyl-substituted 1,2,4-triazoles)
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4hlea2:

Sequence, based on SEQRES records: (download)

>d4hlea2 b.7.1.0 (A:353-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slwdcdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnv
wlefsikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhr
fllrrgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilld

Sequence, based on observed residues (ATOM records): (download)

>d4hlea2 b.7.1.0 (A:353-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slwdcdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnv
wlefsikikdlpkgallnlqiycqllyyvnlllidhrfllrrgeyvlhmwqisfnadklt
satnpdkensmsisilld

SCOPe Domain Coordinates for d4hlea2:

Click to download the PDB-style file with coordinates for d4hlea2.
(The format of our PDB-style files is described here.)

Timeline for d4hlea2: