SCOPe 2.06: Domain d4hlea1: 4hle A:147-320

Lineage for d4hlea1 (4hle A:147-320)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)

8. Domain d4hlea1: 4hle A:147-320 [252463]
   Other proteins in same PDB: d4hlea2, d4hlea3, d4hlea4
   automated match to d1e7ua3
   complexed with 17v

Details for d4hlea1

PDB Entry: 4hle, 2.78 Å

PDB Description: Compound 21 (1-alkyl-substituted 1,2,4-triazoles)

PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4hlea1:

Sequence, based on SEQRES records:

>d4hlea1 d.15.1.0 (A:147-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskp
lpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipesqs
eqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrk

Sequence, based on observed residues (ATOM records):

>d4hlea1 d.15.1.0 (A:147-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskp
lpeylwkkianncifivihrsttsqtikvspddtpgailqsfftdfvlrvcgrdeylvge
tpiknfqwvrhclkngeeihvvldtppdpaldevrk

Timeline for d4hlea1:

• d4hlea1 first appeared in SCOPe 2.04
  
• d4hlea1 appears in SCOPe 2.05
  
• d4hlea1 appears in SCOPe 2.07
  
• d4hlea1 appears in the current release, SCOPe 2.08