Lineage for d4hlea1 (4hle A:147-320)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159468Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2159469Protein automated matches [190233] (22 species)
    not a true protein
  7. 2159501Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)
  8. 2159552Domain d4hlea1: 4hle A:147-320 [252463]
    Other proteins in same PDB: d4hlea2, d4hlea3, d4hlea4
    automated match to d1e7ua3
    complexed with 17v

Details for d4hlea1

PDB Entry: 4hle (more details), 2.78 Å

PDB Description: Compound 21 (1-alkyl-substituted 1,2,4-triazoles)
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4hlea1:

Sequence, based on SEQRES records: (download)

>d4hlea1 d.15.1.0 (A:147-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskp
lpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipesqs
eqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrk

Sequence, based on observed residues (ATOM records): (download)

>d4hlea1 d.15.1.0 (A:147-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskp
lpeylwkkianncifivihrsttsqtikvspddtpgailqsfftdfvlrvcgrdeylvge
tpiknfqwvrhclkngeeihvvldtppdpaldevrk

SCOPe Domain Coordinates for d4hlea1:

Click to download the PDB-style file with coordinates for d4hlea1.
(The format of our PDB-style files is described here.)

Timeline for d4hlea1: