SCOPe 2.08: Domain d4hl7b2: 4hl7 B:151-426

Lineage for d4hl7b2 (4hl7 B:151-426)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.0: automated matches [227169] (1 protein)
   not a true family

6. Protein automated matches [226879] (8 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [226021] (2 PDB entries)

8. Domain d4hl7b2: 4hl7 B:151-426 [252462]
   Other proteins in same PDB: d4hl7a1, d4hl7a3, d4hl7b1, d4hl7b3
   automated match to d3os4a2
   complexed with so4

Details for d4hl7b2

PDB Entry: 4hl7, 1.8 Å

PDB Description: crystal structure of nicotinate phosphoribosyltransferase (target nysgr-026035) from vibrio cholerae

PDB Compounds: (B:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d4hl7b2:

Sequence; same for both SEQRES and ATOM records:

>d4hl7b2 c.1.17.0 (B:151-426) automated matches {Vibrio cholerae [TaxId: 243277]}
vpadlplkvlktkldqlkaeierrginnfsltemgtrrrfssqvqrdvlaclkqeipqwv
lgtsnyhfarefdlkpigtiahewfmghqalvnerdsqqvalerwltafdgmlaiaptdt
ltidaflndfnrhlanaydgvrhdsgcpfrwgdkmiahyqqlgidpttklfifsdgldfd
qalelceyfagrvkisfgigtfltndlanwrnaagveyrplsiviklaecqgrpvakisd
qpekamcedpiflanlkrrfnieldvdaliqelrhq

Timeline for d4hl7b2:

• d4hl7b2 first appeared in SCOPe 2.04
  
• d4hl7b2 appears in SCOPe 2.07