SCOPe 2.05: Domain d4hl7b1: 4hl7 B:2-150

Lineage for d4hl7b1 (4hl7 B:2-150)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families)

5. Family d.41.2.0: automated matches [227168] (1 protein)
   not a true family

6. Protein automated matches [226878] (6 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [226020] (2 PDB entries)

8. Domain d4hl7b1: 4hl7 B:2-150 [252461]
   Other proteins in same PDB: d4hl7a2, d4hl7b2
   automated match to d3os4a1
   complexed with so4

Details for d4hl7b1

PDB Entry: 4hl7, 1.8 Å

PDB Description: crystal structure of nicotinate phosphoribosyltransferase (target nysgr-026035) from vibrio cholerae

PDB Compounds: (B:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d4hl7b1:

Sequence, based on SEQRES records:

>d4hl7b1 d.41.2.0 (B:2-150) automated matches {Vibrio cholerae [TaxId: 243277]}
slnprlfsphiirslldldaykinmmqaihhfypdvsvryelivrseedasglldairqe
iahlgtlrfsdadihyltqhaphlkatflqslryfhfvpqeqvemgivkqggkqqlrisi
rgswrdtilyetlvmaivsevrsrqrwae

Sequence, based on observed residues (ATOM records):

>d4hl7b1 d.41.2.0 (B:2-150) automated matches {Vibrio cholerae [TaxId: 243277]}
slnprlfsphiirslldldaykinmmqaihhfypdvsvryelivrseedasglldairqe
iahlgtlrfsdadihyltqhaphlkatflqslryfhfvpqeqvemgivkgkqqlrisirg
swrdtilyetlvmaivsevrsrqrwae

Timeline for d4hl7b1:

• d4hl7b1 first appeared in SCOPe 2.04
  
• d4hl7b1 appears in SCOPe 2.06
  
• d4hl7b1 appears in the current release, SCOPe 2.08