Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families) |
Family d.41.2.0: automated matches [227168] (1 protein) not a true family |
Protein automated matches [226878] (6 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [226020] (2 PDB entries) |
Domain d4hl7b1: 4hl7 B:2-150 [252461] Other proteins in same PDB: d4hl7a2, d4hl7b2 automated match to d3os4a1 complexed with so4 |
PDB Entry: 4hl7 (more details), 1.8 Å
SCOPe Domain Sequences for d4hl7b1:
Sequence, based on SEQRES records: (download)
>d4hl7b1 d.41.2.0 (B:2-150) automated matches {Vibrio cholerae [TaxId: 243277]} slnprlfsphiirslldldaykinmmqaihhfypdvsvryelivrseedasglldairqe iahlgtlrfsdadihyltqhaphlkatflqslryfhfvpqeqvemgivkqggkqqlrisi rgswrdtilyetlvmaivsevrsrqrwae
>d4hl7b1 d.41.2.0 (B:2-150) automated matches {Vibrio cholerae [TaxId: 243277]} slnprlfsphiirslldldaykinmmqaihhfypdvsvryelivrseedasglldairqe iahlgtlrfsdadihyltqhaphlkatflqslryfhfvpqeqvemgivkgkqqlrisirg swrdtilyetlvmaivsevrsrqrwae
Timeline for d4hl7b1: